Search Results - "Shelukhina, I V"

The First Recombinant Viper Three-Finger Toxins: Inhibition of Muscle and Neuronal Nicotinic Acetylcholine Receptors by Makarova, Ya. V., Kryukova, E. V., Shelukhina, I. V., Lebedev, D. S., Andreeva, T. V., Ryazantsev, D. Yu, Balandin, S. V., Ovchinnikova, T. V., Tsetlin, V. I., Utkin, Yu. N.

“…Genes encoding two three-finger toxins TFT-AF and TFT-VN, nucleotide sequences of which were earlier determined by cloning cDNA from venom glands of vipers…”
Get full text

A New Protein Glosaxin Composed of Noncatalytic Domains of Class PIII Metalloproteinase from the Pit Viper Gloydius saxatilis Venom Inhibits Nicotinic Acetylcholine Receptor by Osipov, A. V., Kryukova, E. V., Ojomoko, L. O., Shelukhina, I. V., Ziganshin, R. H., Starkov, V. G., Andreeva, T. V., Tsetlin, V. I., Utkin, Yu. N.

“…Objective: Although main components of the venoms from Viperidae snakes are hemotoxins, several studies indicate the presence of neurotoxins in these venoms…”
Get full text

Analysis of specificity of antibodies against synthetic fragments of different neuronal nicotinic acetylcholine receptor subunits by Shelukhina, I V, Kryukova, E V, Skok, M V, Lykhmus, E Yu, Zhmak, M N, Mordvintsev, D Yu, Kasheverov, I E, Tsetlin, V I

“…We have compared specificity of a panel of polyclonal antibodies against synthetic fragments of the alpha7 subunit of homooligomeric acetylcholine receptor…”
Get full text

Synthesis and Antimicrobial Activity of a New Drug Based on a Retro-Analog of Cathelicidin—Polypeptide SE-33 by Trenin, A. S., Arzumanian, V. G., Zhmak, M. N., Shelukhina, I. V., Makarova, Ya. V., Ivanov, I. A., Bychkova, O. P., Budikhina, A. S., Balyasova, L. S., Tsetlin, V. I.

“…— Polypeptide SE-33 (SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF), which is a retro analog of natural antimicrobial protein cathelicidin LL-37…”
Get full text

Detection of human neuronal α7 nicotinic acetylcholine receptors by conjugates of snake α-neurotoxin with quantum dots by Makarova, Ya. V., Shelukhina, I. V., Mukherjee, A. K., Kuznetsov, D. V., Tsetlin, V. I., Utkin, Yu. N.

“…Fluorescent derivatives are widely used to study the structure and functions of proteins. Quantum dots (QDs), fluorescent semiconductor nanocrystals, have a…”
Get full text

Possible involvement of neuronal nicotinic acetylcholine receptors in compensatory brain mechanisms at early stages of Parkinson's disease by Kryukova, E V, Shelukhina, I V, Kolacheva, A A, Alieva, A Kh, Shadrina, M I, Slominsky, P A, Kasheverov, I E, Utkin, Y N, Ugrumov, M V, Tsetlin, V I

“…A role of nicotinic acetylcholine receptors (nAChR) in the development of Parkinson's disease (PD) has been investigated using two mouse models corresponding…”
Get more information

Possible involvement of neuronal nicotinic acetylcholine receptors in compensatory brain mechanisms at early stages of Parkinson’s disease by Kryukova, E. V., Shelukhina, I. V., Kolacheva, A. A., Alieva, A. Kh, Shadrina, M. I., Slominsky, P. A., Kasheverov, I. E., Utkin, Y. N., Ugrumov, M. V., Tsetlin, V. I.

“…A role of nicotinic acetylcholine receptors (nAChR) in the development of Parkinson’s disease (PD) has been investigated using two mouse models corresponding…”
Get full text

Analysis of binding centers in nicotinic receptors with the aid of synthetic peptides by Kasheverov, I. E., Kryukova, E. V., Kudryavtsev, D. S., Ivanov, I. A., Egorova, N. V., Zhmak, M. N., Spirova, E. N., Shelukhina, I. V., Odinokov, A. V., Alfimov, M. V., Tsetlin, V. I.

“…We studies the receptor-binding specificity of the synthetic peptide HAP (High Affinity Peptide) and its analogues, which are regarded as a model of the…”
Get full text

Interaction of three-finger proteins from snake venoms and from mammalian brain with the cys-loop receptors and their models by Faure, G., Shelukhina, I. V., Porowinska, D., Shulepko, M. A., Lyukmanova, E. N., Dolgikh, D. A., Spirova, E. N., Kasheverov, I. E., Utkin, Yu. N., Corringer, J. -P., Tsetlin, V. I.

“…With the use of surface plasmon resonance (SPR) it was shown that ws-Lynx1, a water-soluble analog of the three-finger membrane-bound protein Lynx1, that…”
Get full text

Expression of acetylcholine receptors in the brain of mice at the presymptomatic stage of Parkinson’s disease by Kryukova, E. V., Shelukhina, I. V., Kozina, E. A., Ugryumov, M. V., Tsetlin, V. I.

“…The nigrostriatal dopaminergic (DA ergic) system plays a key role in the regulation of motor behavior of animals and humans [1]. In turn, DA ergic neurons of…”
Get full text

Polypeptide and peptide neurotoxins for identification of nicotinic acetylcholine receptors and for study of their structure by Kasheverov, I. E., Utkin, Yu. N., Shelukhina, I. V., Kryukova, E. V., Kuzmin, D. A., Osipov, A. V., Zhmak, M. N., Tsetlin, V. I.

Get full text

Detection of the silicic acid transport protein in the freshwater diatom Synedra acus by immunoblotting and immunoelectron microscopy by Petrova, D P, Bedoshvili, Ye D, Shelukhina, I V, Samukov, V V, Korneva, E S, Vereshagin, A L, Popkova, T P, Karpyshev, N N, Lebedeva, D V, Klimenkov, I V, Likhoshway, Ye V, Grachev, M A

“…(ProQuest: Abstract omitted; see image)[PUBLICATION ABSTRACT]…”
Get full text

Detection of human neuronal [alpha]7 nicotinic acetylcholine receptors by conjugates of snake [alpha]-neurotoxin with quantum dots by Makarova, Ya V, Shelukhina, I V, Mukherjee, A K, Kuznetsov, D V, Tsetlin, V I, Utkin, Yu N

“…Fluorescent derivatives are widely used to study the structure and functions of proteins. Quantum dots (QDs), fluorescent semiconductor nanocrystals, have a…”
Get full text