Search Results - "Rispoli, Giorgio"

Cation Permeability of Voltage-Gated Hair Cell Ca2+ Channels of the Vertebrate Labyrinth by Martini, Marta, Rispoli, Giorgio

“…Some hearing, vestibular, and vision disorders are imputable to voltage-gated Ca2+ channels of the sensory cells. These channels convey a large Ca2+ influx…”
Get full text

Reproducibility and Repeatability Tests on (SnTiNb)O2 Sensors in Detecting ppm-Concentrations of CO and Up to 40% of Humidity: A Statistical Approach by Astolfi, Michele, Rispoli, Giorgio, Gherardi, Sandro, Zonta, Giulia, Malagù, Cesare

“…Nowadays, most medical-diagnostic, environmental monitoring, etc. devices employ sensors whose fabrication reproducibility and response repeatability…”
Get full text

Advanced real-time recordings of neuronal activity with tailored patch pipettes, diamond multi-electrode arrays and electrochromic voltage-sensitive dyes by Kuhn, Bernd, Picollo, Federico, Carabelli, Valentina, Rispoli, Giorgio

“…To understand the working principles of the nervous system is key to figure out its electrical activity and how this activity spreads along the neuronal…”
Get full text

Where vision begins by Dell’Orco, Daniele, Koch, Karl-Wilhelm, Rispoli, Giorgio

Get full text

Tin, Titanium, Tantalum, Vanadium and Niobium Oxide Based Sensors to Detect Colorectal Cancer Exhalations in Blood Samples by Astolfi, Michele, Rispoli, Giorgio, Anania, Gabriele, Artioli, Elena, Nevoso, Veronica, Zonta, Giulia, Malagù, Cesare

“…User-friendly, low-cost equipment for preventive screening of severe or deadly pathologies are one of the most sought devices by the National Health Services,…”
Get full text

Overview of Gas Sensors Focusing on Chemoresistive Ones for Cancer Detection by Zonta, Giulia, Rispoli, Giorgio, Malagù, Cesare, Astolfi, Michele

“…The necessity of detecting and recognizing gases is crucial in many research and application fields, boosting, in the last years, their continuously evolving…”
Get full text

Nanostructured Chemoresistive Sensors for Oncological Screening and Tumor Markers Tracking: Single Sensor Approach Applications on Human Blood and Cell Samples by Landini, Nicolò, Anania, Gabriele, Astolfi, Michele, Fabbri, Barbara, Guidi, Vincenzo, Rispoli, Giorgio, Valt, Matteo, Zonta, Giulia, Malagù, Cesare

“…Preventive screening does not only allow to preemptively intervene on pathologies before they can harm the host; but also to reduce the costs of the…”
Get full text

Characterization of Zebrafish Green Cone Photoresponse Recorded with Pressure-Polished Patch Pipettes, Yielding Efficient Intracellular Dialysis by Aquila, Marco, Benedusi, Mascia, Fasoli, Anna, Rispoli, Giorgio

“…The phototransduction enzymatic cascade in cones is less understood than in rods, and the zebrafish is an ideal model with which to investigate vertebrate and…”
Get full text

A Portable Device for I–V and Arrhenius Plots to Characterize Chemoresistive Gas Sensors: Test on SnO2-Based Sensors by Astolfi, Michele, Zonta, Giulia, Gherardi, Sandro, Malagù, Cesare, Vincenzi, Donato, Rispoli, Giorgio

“…Chemoresistive nanostructured gas sensors are employed in many diverse applications in the medical, industrial, environmental, etc. fields; therefore, it is…”
Get full text

Investigating the Temperature-Dependent Kinetics in Humidity-Resilient Tin–Titanium-Based Metal Oxide Gas Sensors by Gherardi, Sandro, Astolfi, Michele, Gaiardo, Andrea, Malagù, Cesare, Rispoli, Giorgio, Vincenzi, Donato, Zonta, Giulia

“…Humidity is a well-known interference factor in metal oxide (MOX) gas sensors, significantly impacting their performance in various applications such as…”
Get full text

Chemoresistive Sensors for Cellular Type Discrimination Based on Their Exhalations by Astolfi, Michele, Rispoli, Giorgio, Benedusi, Mascia, Zonta, Giulia, Landini, Nicolò, Valacchi, Giuseppe, Malagù, Cesare

“…The detection of volatile organic compounds (VOCs) exhaled by human body fluids is a recent and promising method to reveal tumor formations. In this…”
Get full text

Mechanistic insight into CM18-Tat11 peptide membrane-perturbing action by whole-cell patch-clamp recording by Fasoli, Anna, Salomone, Fabrizio, Benedusi, Mascia, Boccardi, Claudia, Rispoli, Giorgio, Beltram, Fabio, Cardarelli, Francesco

“…The membrane-destabilization properties of the recently-introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of…”
Get full text

Pore forming properties of cecropin-melittin hybrid peptide in a natural membrane by Milani, Alberto, Benedusi, Mascia, Aquila, Marco, Rispoli, Giorgio

“…The pore forming properties of synthetic cecropin-melittin hybrid peptide (Acetyl-KWKLFKKIGAVLKVL-CONH(2); CM15) were investigated by using photoreceptor rod…”
Get full text

Colorectal Cancer Study with Nanostructured Sensors: Tumor Marker Screening of Patient Biopsies by Astolfi, Michele, Rispoli, Giorgio, Anania, Gabriele, Nevoso, Veronica, Artioli, Elena, Landini, Nicolò, Benedusi, Mascia, Melloni, Elisabetta, Secchiero, Paola, Tisato, Veronica, Zonta, Giulia, Malagù, Cesare

“…Despite the great progress in screening techniques and medical treatments, colorectal cancer remains one of the most widespread cancers in both sexes, with a…”
Get full text

Studying the Mechanism of Membrane Permeabilization Induced by Antimicrobial Peptides Using Patch-Clamp Techniques by Rispoli, Giorgio

“…Many short peptides selectively permeabilize the bacteria plasma membrane, leading to their lyses and death: they are therefore a source of antibacterial…”
Get more information

Pore-Forming Properties of Alamethicin F50/5 Inserted in a Biological Membrane by Vedovato, Natascia, Baldini, Chiara, Toniolo, Claudio, Rispoli, Giorgio

“…The pore‐forming properties of native and synthetic alamethicins were investigated in photoreceptor rod outer segments (OS) isolated from frog retina, and…”
Get full text

Cation Permeability of Voltage-Gated Hair Cell Ca 2+ Channels of the Vertebrate Labyrinth by Martini, Marta, Rispoli, Giorgio

“…Some hearing, vestibular, and vision disorders are imputable to voltage-gated Ca channels of the sensory cells. These channels convey a large Ca influx despite…”
Get full text

Reproducibility and Repeatability Tests on O[sub.2] Sensors in Detecting ppm-Concentrations of CO and Up to 40% of Humidity: A Statistical Approach by Astolfi, Michele, Rispoli, Giorgio, Gherardi, Sandro, Zonta, Giulia, Malagù, Cesare

“…Nowadays, most medical-diagnostic, environmental monitoring, etc. devices employ sensors whose fabrication reproducibility and response repeatability…”
Get full text

The possible modulation of NRF2 and NF-kB crosstalk by Sulforaphane in the progression of human melanoma by Benedusi, Mascia, Canella, Rita, Vallese, Andrea, Casoni, Alice, Guerra, Martina, Rispoli, Giorgio, Ferrara, Francesca, Cervellati, Franco, Valacchi, Giuseppe

Get full text

The role of potassium current in the pulmonary response to environmental oxidative stress by Canella, Rita, Benedusi, Mascia, Vallese, Andrea, Pecorelli, Alessandra, Guiotto, Anna, Ferrara, Francesca, Rispoli, Giorgio, Cervellati, Franco, Valacchi, Giuseppe

“…Exposure of human lung epithelial cells (A549 cell line) to the oxidant pollutant ozone (O3) alters cell membrane currents inducing its decrease, when the cell…”
Get full text