Search Results - "Rajewska, Anna"

Specificity of the zinc(II), magnesium(II) and calcium(II) complexation by (pyridin-2-yl)aminomethane-1,1-diphosphonic acids and related 1,3-(thiazol-2-yl) and 1,3-(benzothiazol-2-yl) derivatives by Matczak-Jon, Ewa, Kowalik-Jankowska, Teresa, Slepokura, Katarzyna, Kafarski, Paweł, Rajewska, Anna

“…The solution properties of a series of (pyridin-2-yl)aminomethane-1,1-diphosphonic acids 1-4 as well as closely related compounds 5 and 6 with 1,3-thiazolyl or…”
Get more information

Products of Cu(II)-catalyzed oxidation of the N-terminal fragments of α-synuclein in the presence of hydrogen peroxide by Kowalik-Jankowska, Teresa, Rajewska, Anna, Jankowska, Elżbieta, Wiśniewska, Kornelia, Grzonka, Zbigniew

“…Reactive oxygen species (ROS) may provide the covalent modifications of amino acid residues in proteins, formation of protein–protein cross-linkages, and…”
Get full text

Coordination abilities of N-terminal fragments of α-synuclein towards copper(II) ions: A combined potentiometric and spectroscopic study by Kowalik-Jankowska, Teresa, Rajewska, Anna, Wiśniewska, Kornelia, Grzonka, Zbigniew, Jezierska, Julia

“…Copper(II) complexes of the 1–17 (MDVFMKGLSKAKEGVVA-NH 2), 1–28 (MDVFMKGLSKAKEGVVAAAEKTKQGVAE-NH 2), 1–39 (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLY-NH 2) and…”
Get full text

Copper(II) binding by fragments of alpha-synuclein containing M1-D2- and -H50-residues; a combined potentiometric and spectroscopic study by Kowalik-Jankowska, Teresa, Rajewska, Anna, Jankowska, Elzbieta, Grzonka, Zbigniew

“…Stability constants and ligand donor sets of the copper(II) complexes of the NH2-29-56(L1)(AA30GKTKEGVLYV40GSKTKEGVVH50GVATVA56-NH2), NH2-M29-D30-56(L2) and…”
Get more information

Products of Cu(II)-catalyzed oxidation of alpha-synuclein fragments containing M1-D2 and H50 residues in the presence of hydrogen peroxide by Kowalik-Jankowska, Teresa, Rajewska, Anna, Jankowska, Elzbieta, Grzonka, Zbigniew

“…Metal-catalyzed oxidation (MCO) of proteins is mainly a site-specific process in which one or a few amino acids at metal-binding sites on the protein are…”
Get more information

Bonding of copper(II) ions by proctolin analogues modified in fifth position of the peptide chain by Kowalik-Jankowska, Teresa, Rajewska, Anna, Szeszel-Fedorowicz, Wioletta, Konopińska, Danuta

“…The amine group of the 2,4-diamminobutyric acid (Dab) residue of the proctolin analogue RYLP–Dab, in whole pH range (2.5–10.5) is coordinated to the copper(II)…”
Get full text