Search Results - "Rajewska, A."

The assessment of stress level, anxiety, depressive symptoms, and defense mechanisms among Polish and English medical students by Pawlaczyk, M, Siembida, J, Balaj, K, Rajewska-Rager, A

“…Medical education is proven to be associated with a high degree of psychological stress. Different coping strategies used by students have been investigated on…”
Get full text

The link between personality dimensions, impulsivity, decision and coping style, and suicide attempts in affective patients by Pawlak, J M, Bilska, K, Skibińska, M, Narożna, B, Zakowicz, P, Rajewska-Rager, A, Kapelski, P, Dmitrzak-Węglarz, M

“…IntroductionIntroduction: Affective patients, especially depressive, have an increased risk of suicidal behavior. Identifying individuals at increased risk…”
Get full text

Assessment of various dimensions of impulsivity and their expression in unipolar and bipolar affective disorder by Dmitrzak-Weglarz, M, Bilska, K, Skibińska, M, Narożna, B, Zakowicz, P, Rajewska-Rager, A, Kapelski, P, Pawlak, J M

“…IntroductionImpulsivity is the tendency to take quick and rash actions without the ability to assess their consequences, resulting in an increased frequency of…”
Get full text

Small-angle neutron scattering study of the structure of mixed micellar solutions based on heptaethylene glycol monotetradecyl ether and cesium dodecyl sulfate by Rajewska, A., Medrzycka, K., Hallmann, E., Soloviov, D. V.

“…The micellization in mixed aqueous systems based on a nonionic surfactant, heptaethylene glycol monotetradecyl ether (C 14 E 7 ), and an anionic surfactant,…”
Get full text

Small-angle neutron scattering study of the structure of mixed micellar solutions based on nonionic and two cationic surfactants by Rajewska, A., Medrzycka, K., Hallmann, E.

“…The aggregation in mixed water systems based on nonionic surfactant, i.e., heptaethylene glycol monotetradecyl ether (C14E7), and cationic surfactants, i.e.,…”
Get full text

Cognitive functions and mood during chronic thyrotropin-suppressive therapy with L-thyroxine in patients with differentiated thyroid carcinoma by Jaracz, J, Kucharska, A, Rajewska-Rager, A, Lacka, K

“…Subclinical thyroid dysfunctions may cause cognitive deficits and mood disorders. Chronic TSH-suppressive therapy with L-T(4) causing subclinical…”
Get full text

Emotional intelligence and impulsivity in patients with affective and psychotic disorders by Golec, M.E, Rajewska-Rager, A, Krawczyk, K, Szymaniuk, W, Marć, J, Trzeciak, K, Niemczyńska, J, Więckowska, B

Get full text

P.1.a.007 FKBP5 single markers and haplotypes predispose to major depressive disorder in Polish patients by Narozna, B, Szczepankiewicz, A, Leszczynska-Rodziewicz, A, Pawlak, J, Wilkosc, M, Rajewska-Rager, A, Maciukiewicz, M, Twarowska-Hauser, J

Get full text

Cognitive functions andmood during chronic thyrotropin-suppressive therapy with L-thyroxine in patients with differentiated thyroid carcinoma by Jaracz, J., Kucharska, A., Rajewska-Rager, A., Łaącka, K.

“…Background Subclinical thyroid dysfunctions may cause cognitive deficits and mood disorders. Chronic TSH-suppressive therapy with L-T 4 causing subclinical…”
Get full text

Structure of Dilute Micellar Water Solutions of Nonionic Dimeric Surfactant Study by Small Angle Neutron Scattering Method by Rajewska, A., Wilk, K.A.

Get full text

P.2.b.011 Association of CRHR1 gene variation with bipolar disorder and major depressive disorder by Szczepankiewicz, O, Leszczynska-Rodziewicz, A, Pawlak, J, Rajewska-Rager, A, Dmitrzak-Weglarz, M, Skibinska, M, Wilkosc, M, Hauser, J

Get full text

Novel inflammatory markers of labor following premature preterm rupture of membranes by Rzepka, R., Dołęgowska, B., Marczuk, N., Kwiatkowski, S., Rajewska, A., Nurek, K., Torbè, A.

Get full text

Cognitive dysfunctions during chronic Thyrotropin-suppressive therapy with levothyroxine in patients with differentiated thyroid carcinoma by Jaracz, J, Kucharska, A, Rajewska-Rager, A, Łącka, K

Get full text

P.1.a.025 Association study of rs6916861 polymorphism of the FYN gene in bipolar disorder and it subtypes by Leszczynska-Rodziewicz, A, Rajewska-Rager, A, Szczepankiewicz, A, Skibinska, M, Dmitrzak-Weglarz, M, Hauser, J

Get full text

P.1.a.024 Association study of rs2289656, polymorphism of the NTRK2 gene with bipolar disorder and it subtypes by Rajewska-Rager, A, Leszczynska-Rodziewicz, A, Szczepankiewicz, A, Skibinska, M, Dmitrzak-Weglarz, M, Hauser, J

Get full text

P.2.c.030 Melancholic and nonmelancholic subtype of depression and efficacy of antidepressants treatment by Rajewska-Rager, A, Kapelski, P, Dmitrzak-Weglarz, M, Hauser, J

Get full text

P.1.a.023 No association between dopamine receptor D4 521 c/t gene polymorphism and bipolar disorder and it subtypes by Rajewska-Rager, A, Leszczynska-Rodziewicz, A, Dmitrzak-Weglarz, M, Skibinska, M, Rybakowski, J.K, Hauser, J

Get full text

Coordination abilities of N-terminal fragments of α-synuclein towards copper(II) ions: A combined potentiometric and spectroscopic study by Kowalik-Jankowska, Teresa, Rajewska, Anna, Wiśniewska, Kornelia, Grzonka, Zbigniew, Jezierska, Julia

“…Copper(II) complexes of the 1–17 (MDVFMKGLSKAKEGVVA-NH 2), 1–28 (MDVFMKGLSKAKEGVVAAAEKTKQGVAE-NH 2), 1–39 (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLY-NH 2) and…”
Get full text

P.1.a.019 Association studies of 5HT2A and 5HTTLPR polymorphisms and drug response in depression patients by Dmitrzak-Weglarz, M, Rajewska-Rager, A, Gattner, K, Kapelski, P, Kaczmarkiewicz-Fass, M, Slopien, A, Leszczynska-Rodziewicz, A, Hauser, J

Get full text

P.2.d.025 Lack of association of 1287A/G NET and Val66Met BDNF polymorphisms with response to antidepressants by Szczepankiewicz, A, Rajewska-Rager, A, Dmitrzak-Weglarz, M, Gattner, K, Kapelski, P, Kaczmarkiewicz-Fass, M, Slopien, A, Leszynska-Rodziewicz, A, Hauser, J

Get full text