Search Results - "Pisarenko, O I"

Mitochondria-targeted plastoquinone derivatives as tools to interrupt execution of the aging program. 2. Treatment of some ROS- and Age-related diseases (heart arrhythmia, heart infarctions, kidney ischemia, and stroke) by Bakeeva, L. E., Barskov, I. V., Egorov, M. V., Isaev, N. K., Kapelko, V. I., Kazachenko, A. V., Kirpatovsky, V. I., Kozlovsky, S. V., Lakomkin, V. L., Levina, S. B., Pisarenko, O. I., Plotnikov, E. Y., Saprunova, V. B., Serebryakova, L. I., Skulachev, M. V., Stelmashook, E. V., Studneva, I. M., Tskitishvili, O. V., Vasilyeva, A. K., Victorov, I. V., Zorov, D. B., Skulachev, V. P.

“…Effects of 10-(6′-plastoquinonyl) decyltriphenylphosphonium (SkQ1) and 10-(6′-plastoquinonyl) decylrhod-amine 19 (SkQR1) on rat models of H 2 O 2 - and…”
Get full text

Apelin-12 and its structural analog enhance antioxidant defense in experimental myocardial ischemia and reperfusion by Pisarenko, O. I., Lankin, V. Z., Konovalova, G. G., Serebryakova, L. I., Shulzhenko, V. S., Timoshin, A. A., Tskitishvili, O. V., Pelogeykina, Yu. A., Studneva, I. M.

“…This study investigated the effects of peptide apelin-12 (H-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH, A12) and its novel structural analog (H-(N α…”
Get full text

Synthesis of the Antagonist of the GalR2 Galanin Receptor and Studies of Its Biological Activity in Ischemia and Reperfusion of the Rat Heart In Vivo by Sidorova, M. V., Palkeeva, M. E., Avdeev, D. V., Studneva, I. M., Serebryakova, L. I., Veselova, O. M., Dobrokhotov, I. V., Molokoedov, A. S., Pisarenko, O. I.

“…The dose-dependent action of the M871 synthetic peptide antagonist of the GalR2 galanin receptor…”
Get full text

Anti-Ischemic and Antioxidant Activity of the Pharmacological Agonist of Galanin Receptor GalR2 and Carnosine in In Vitro and In Vivo Model Systems by Serebryakova, L. I., Studneva, I. M., Veselova, O. M., Dobrokhotov, I. V., Konovalova, G. G., Timoshin, A. A., Abramov, A. A., Avdeev, D. V., Sidorova, M. V., Lankin, V. Z., Pisarenko, O. I.

“…Antioxidant and anti-ischemic properties of the pharmacological agonist of galanin receptor GalR2 WTLNSAGYLLGPβAH (Gal) and its C-terminal fragment, dipeptide…”
Get full text

Identifying the Formation Cause of Ghost Line (Contour) Macrostructure Defects by Glazunova, N. A., Shapovalova, L. I., Stefanovich, S. V., Kovalyova, I. A., Pisarenko, I. O.

“…State Standard GOST 4543–2016 stipulates for more stringent requirements of ghost line (contour) macrostructure defects for alloyed steel. State Standard GOST…”
Get full text

The mechanisms of cardiac protection using a synthetic agonist of galanin receptors during chronic administration of doxorubicin by Studneva, Irina M., Veselova, Oksana М., Bahtin, Arthur A., Konovalova, Galina G., Lankin, Vadim Z., Pisarenko, Oleg I.

“…The use of the anticancer drug doxorubicin (Dox) is limited by its cardiotoxic effect. The aim of this work was to study the effect of a new synthetic agonist…”
Get full text

Convergent Synthesis of the Rat Galanin and Study of Its Biological Activity by Sidorova, M. V., Palkeeva, M. E., Avdeev, D. V., Molokoedov, A. S., Ovchinnikov, M. V., Azmuko, A. A., Serebryakova, L. I., Veselova, O. M., Studneva, I. M., Pisarenko, O. I.

“…The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH 2 , G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide…”
Get full text

Fragments of the Galanin Peptide and Their Synthetic Analogues with the Cardioprotective Effect by Palkeeva, M. E., Sidorova, M. V., Molokoedov, A. S., Ovchinnikov, M. V., Az’muko, A. A., Serebryakova, L. I., Veselova, O. M., Studneva, I. M., Pisarenko, O. I.

“…New peptide analogs of galanin corresponding to fragments of the N -terminal sequence were synthesized by an automatic solid-phase method using…”
Get full text

Optimization of the Synthesis of an Apelin-12 Structural Analog and the NMR Study of Its Stability in Human Plasma by Sidorova, M. V., Palkeeva, M. E., Azmuko, A. A., Ovchinnikov, M. V., Molokoedov, A. S., Bushuev, V. N., Pisarenko, O. I.

“…A method for the solid-phase synthesis of the apelin-12 analog has been developed using the Fmoc methodology in combination with the temporary protection of…”
Get full text

Protective Action of a Modified Galanin Fragment in Rats with Doxorubicin-Induced Heart Failure by Studneva, I. M., Palkeeva, M. E., Veselova, O. M., Molokoedov, A. S., Lubimov, R. O., Ovchinnikov, M. V., Sidorova, M. V., Pisarenko, O. I.

“…The clinical application of the anticancer agent doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automated solid-phase peptide…”
Get full text

Antioxidant Action of Apelin-12 Peptide and Its Structural Analog In Vitro by Pelogeykina, Y. A., Konovalova, G. G., Pisarenko, O. I., Lankin, V. Z.

“…The effects of C-terminal fragment of natural peptide apelin-12 H-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (A12) and its structural analog H-(N α…”
Get full text

Contractile Function of Isolated Hearts With Preserved and Reduced Ejection Fraction In Vivo by Lakomkin, V L, Abramov, A A, Gramovich, V V, Vyborov, O N, Studneva, I M, Pisarenko, O I, Kapelko, V I

“…The aim of the study was comparison of contractile function of isolated hearts of rats with doxorubicin-induced myocardial injury which were tentatively…”
Get more information

In Vivo Reduction of Reperfusion Injury to the Heart with Apelin-12 Peptide in Rats by Pisarenko, O. I., Serebryakova, L. I., Pelogeykina, Yu. A., Studneva, I. M., Khatri, D. N., Tskitishvili, O. V., Bespalova, Zh. D., Az’muko, A. A., Sidorova, M. V., Pal’keeva, M. E.

“…Apelin-12 (A-12) peptide was synthesized by automated solid phase method and purified by reverse phase HPLC. Its homogeneity and structure were confirmed by…”
Get full text

Inhibitor of beta-hydroxy-beta-methylglutaryl coenzyme A reductase decreases energy supply to the myocardium in rats by Pisarenko, O I, Studneva, I M, Lankin, V Z, Konovalova, G G, Tikhaze, A K, Kaminnaya, V I, Belenkov, Y N

“…Hypocholesterolemic preparations, inhibitors of the key enzyme of cholesterol biosynthesis beta-hydroxy-beta-methylglutaryl coenzyme A reductase (statins),…”
Get full text

Involvement of NO-dependent mechanisms of apelin action in myocardial protection against ischemia/reperfusion damage by Pisarenko, O I, Serebriakova, L I, Pelogeĭkina, Iu A, Studneva, I M, Kkhatri, D N, Tskitishvili, O V, Bespalova, Zh D, Az'muko, A A, Sidorova, M V, Pal'keeva, M E, Chazov, E I

“…Apelin 12 (A-12) was synthesized by the automatic solid phase method with the use of Fmoc technology. The synthesized peptide was purified by preparative HPLC…”
Get more information

Limitation of myocardial infarction by a structural analog of the peptide apelin-12 by Pisarenko, O. I., Pelogeykina, Yu. A., Bespalova, Zh. D., Serebryakova, L. I., Sidorova, M. V., Az’muko, A. A., Khatri, D. N., Studneva, I. M., Pal’keeva, M. E., Tskitishvili, O. V., Molokoedov, A. S.

Get full text

Antioxidant properties of apelin-12 and its structural analogue in experimental ischemia and reperfusion by Pisarenko, O I, Bespalova, Zh D, Lankin, V Z, Timoshin, A A, Serebriakova, L I, Shul'zhenko, V S, Pelogeĭkina, Iu A, Studneva, I M, Tskitishvili, O V, Az'muko, A A, Sidorova, M V, Pal'keeva, M E, Konovalova, G G, Chazov, E I

“…Effects of apelin-12 H-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH (A12) and its modified analogue…”
Get more information

Cardiac metabolism and performance during L-glutamic acid infusion in postoperative cardiac failure by Pisarenko, O I, Lepilin, M G, Ivanov, V E

“…Intravenous infusion of L-glutamic acid results in the augmentation of the cardiac output and an improvement of the circulation in patients with postoperative…”
Get more information

Human recombinant extracellular-superoxide dismutase type C improves cardioplegic protection against ischemia/reperfusion injury in isolated rat heart by Pisarenko, O I, Studneva, I M, Lakomkin, V L, Timoshin, A A, Kapelko, V I

“…The cardioprotective effects of human recombinant extracellular-superoxide dismutase type C (hr-EC-SOD C) were compared with those of bovine Cu,Zn-SOD in…”
Get more information

Effects of exogenous apelin-12 on functional and metabolic recovery of isolated rat heart after ischemia by Pisarenko, O I, Shulzhenko, V S, Pelogeĭkina, Iu A, Studneva, I M, Kkhatri, D N, Bespalova, Zh D, Az'muko, A A, Sidorova, M V, Pal'keeva, M E

“…Apelin 12 (A 12) was synthesized by the automatic solid phase method with the use of Fmoc technology. The synthesized peptide was purified by preparative HPLC…”
Get more information