Search Results - "Nomizo, Auro"

Peroxisome Proliferator-Activated Receptor Alpha Mediates the Beneficial Effects of Atorvastatin in Experimental Colitis by Basso, Paulo José, Sales-Campos, Helioswilton, Nardini, Viviani, Duarte-Silva, Murillo, Alves, Vanessa Beatriz Freitas, Bonfá, Giuliano, Rodrigues, Cassiano Costa, Ghirotto, Bruno, Chica, Javier Emílio Lazo, Nomizo, Auro, Cardoso, Cristina Ribeiro de Barros

“…The current therapeutic options for Inflammatory Bowel Diseases (IBD) are limited. Even using common anti-inflammatory, immunosuppressive or biological…”
Get full text

Mechanism of the cytotoxic effect of l-amino acid oxidase isolated from Bothrops alternatus snake venom by Ribeiro, Patrícia H., Zuliani, Juliana P., Fernandes, Carla F.C., Calderon, Leonardo A., Stábeli, Rodrigo G., Nomizo, Auro, Soares, Andreimar M.

“…BaltLAAO-I, an L-amino acid oxidase isolated from Bothrops alternatus, is a glycoprotein enzyme with a pI⿿5.3, 15% sugar and a related molecular mass of…”
Get full text

Effects of Periodontal Therapy on Glycemic Control and Inflammatory Markers by O'Connell, Patricia A.A., Taba, Mario, Nomizo, Auro, Foss Freitas, Maria C., Suaid, Flavia A., Uyemura, Sergio A., Trevisan, Glauce L., Novaes, Arthur B., Souza, Sergio L.S., Palioto, Daniela B., Grisi, Marcio F.M.

“…Background: Periodontitis, a complication of diabetes mellitus (DM), can induce or perpetuate systemic conditions. This double‐masked, placebo‐controlled study…”
Get full text

Effect of iontophoresis on topical delivery of doxorubicin-loaded solid lipid nanoparticles by Taveira, Stephânia F, De Santana, Danielle C A S, Araújo, Luciana M P C, Marquele-Oliveira, Franciane, Nomizo, Auro, Lopez, Renata F V

“…The combination of iontophoresis with solid lipid nanoparticles (SLNs) for targeting drug delivery to the epidermis has not been explored. The goal of this…”
Get more information

Effect of Lactobacillus rhamnosus GR-1 and Lactobacillus reuteri RC-14 on the ability of Candida albicans to infect cells and induce inflammation by Martinez, Rafael C.R., Seney, Shannon L., Summers, Kelly L., Nomizo, Auro, De Martinis, Elaine C.P., Reid, Gregor

“…ABSTRACT Vulvovaginal candidiasis, a high prevailing infection worldwide, is mainly caused by Candida albicans. Probiotic Lactobacillus reuteri RC‐14 and…”
Get full text

In vitro evaluation of the probiotic potential of bacteriocin producer Lactobacillus sakei 1 by Gomes, Bruna C, Rodrigues, Marina R, Winkelströter, Lizziane K, Nomizo, Auro, de Martinis, Elaine C P

“…Lactobacillus sakei 1 is a food isolate that produces a heat-stable antimicrobial peptide (sakacin 1, a class IIa bacteriocin) inhibitory to the opportunistic…”
Get more information

Participation of Leukotrienes in the Immune Modulation of Oral Tolerance by de Oliveira, Sandra R P, Nomizo, Auro, Frantz, Fabiani G, Faccioli, Lúcia H, de Matos, Ana Paula Keller, Carrilho, Emanuel, Afonso, Ana, de Freitas Anibal, Fernanda

“…Oral tolerance (OT) is characterized as a peripheral immune tolerance form, in which, mature lymphocytes in lymphoid tissues associated with mucosa, become…”
Get full text

Adrenal-Derived Hormones Differentially Modulate Intestinal Immunity in Experimental Colitis by Cardoso, Cristina Ribeiro Barros, Nomizo, Auro, Alves, Vanessa Beatriz Freitas, Banquieri, Fernanda, Silva, Angelica, Nardini, Viviani, Basso, Paulo José, Sales-Campos, Helioswilton, Souza, Patrícia Reis de, Lazo-Chica, Javier Emilio

“…The adrenal glands are able to modulate immune responses through neuroimmunoendocrine interactions and cortisol secretion that could suppress exacerbated…”
Get full text

Cytotoxic l-amino acid oxidase from Bothrops moojeni: Biochemical and functional characterization by Stábeli, Rodrigo G., Sant’Ana, Carolina D., Ribeiro, Patrícia H., Costa, Tássia R., Ticli, Fábio K., Pires, Matheus G., Nomizo, Auro, Albuquerque, Sérgio, Malta-Neto, Natael R., Marins, Mozart, Sampaio, Suely V., Soares, Andreimar M.

“…An l-amino acid oxidase isolated from Bothrops moojeni snake venom (BmooLAAO-I) was purified to a high degree using sequential CM-Sepharose ion-exchange and…”
Get full text

Vaginal lactobacilli as potential probiotics against Candida spp by Gil, Natalia F.(Universidade de São Paulo Faculdade de Ciências Farmacêuticas), Martinez, Rafael C.R.(Universidade de São Paulo Faculdade de Ciências Farmacêuticas), Gomes, Bruna C.(Universidade de São Paulo Faculdade de Ciências Farmacêuticas), Nomizo, Auro(Universidade de São Paulo Faculdade de Ciências Farmacêuticas), Martinis, Elaine C. P. De(Universidade de São Paulo Faculdade de Ciências Farmacêuticas)

“…Urogenital infections affect millions of people every year worldwide. The treatment of these diseases usually requires the use of antimicrobial agents, and…”
Get full text

Chemical constituents from Tabernaemontana catharinensis root bark: a brief NMR review of indole alkaloids and in vitro cytotoxicity by Pereira, Paulo Sérgio, França, Suzelei de Castro, Oliveira, Paulo Vinicius Anderson de, Breves, Camila Moniz de Souza, Pereira, Sarazete Izidia Vaz, Sampaio, Suely Vilela, Nomizo, Auro, Dias, Diones Aparecida

“…This work describes the isolation and structural determination of pharmacological compounds present in the bark of roots of Tabernaemontana catharinensis…”
Get full text

The Acute Phase of Trypanosoma cruzi Infection Is Attenuated in 5-Lipoxygenase-Deficient Mice by Faccioli, Lúcia Helena, Nomizo, Auro, Aronoff, David M., Cunha, Fernando Queiroz, Trindade, Bruno C., de Sousa, Érika V. G., Morais, Fabiana R., Martins, Vicente P., Artério Sorgi, Carlos, Canavaci, Adriana M. C., Rossi, Marcos A.

“…In the present work we examine the contribution of 5-lipoxygenase- (5-LO-) derived lipid mediators to immune responses during the acute phase of Trypanosoma…”
Get full text

In vitro Antitumour Activity of Orsellinates by Bogo, Danielle, Matos, Maria de Fatima Cepa, Honda, Neli Kika, Pontes, Elenir Curi, Oguma, Patricia Midori, Santos, Evelyn Cristina da Silva, Carvalho, João Ernesto de, Nomizo, Auro

“…Lichen phenolic compounds exhibit antioxidant, antimicrobial, antiproliferative, and cytotoxic activities. The purpose of this study was to evaluate the…”
Get full text

ATP-induced apoptosis involves a Ca2+-independent phospholipase A2 and 5-lipoxygenase in macrophages by Costa-Junior, Helio Miranda, Mendes, Anderson Nogueira, Davis, Gustavo Henrique Nolasco Grimmer, da Cruz, Cristiane Monteiro, Ventura, Ana Lúcia Marques, Serezani, Carlos Henrique, Faccioli, Lucia Helena, Nomizo, Auro, Freire-de-Lima, Célio G, Bisaggio, Rodrigo da Cunha, Persechini, Pedro Muanis

“…Macrophages express P2X(7) and other nucleotide (P2) receptors, and display the phenomena of extracellular ATP (ATP(e))-induced P2X(7)-dependent membrane…”
Get full text

Antitumoral Activity of Snake Venom Proteins : New Trends in Cancer Therapy by Nomizo, Auro, Fernandes, Carla F. C., Zuliani, Juliana P., Carvalho, Bruna M. A., da Silva, Saulo Luís, Stábeli, Rodrigo G., Soares, Andreimar Martins, Calderon, Leonardo A., Marcussi, Silvana, Mazzi, Maurício V., Grabner, Amy N., Sobrinho, Juliana C., Zaqueo, Kayena D., de Moura, Andrea A.

“…For more than half a century, cytotoxic agents have been investigated as a possible treatment for cancer. Research on animal venoms has revealed their high…”
Get full text

Protective effect of Calendula officinalis extract against UVB-induced oxidative stress in skin: Evaluation of reduced glutathione levels and matrix metalloproteinase secretion by Fonseca, Yris Maria, Catini, Carolina Dias, Vicentini, Fabiana T.M.C., Nomizo, Auro, Gerlach, Raquel Fernanda, Fonseca, Maria José Vieira

“…Calendula officinalis flowers have long been employed time in folk therapy, and more than 35 properties have been attributed to decoctions and tinctures from…”
Get full text

Effect of the iontophoresis of a chitosan gel on doxorubicin skin penetration and cytotoxicity by Taveira, Stephânia F., Nomizo, Auro, Lopez, Renata F.V.

“…The aim of this work was to investigate doxorubicin (DOX) percutaneous absorption and retention in the skin following iontophoresis. The convective flow…”
Get full text

Amelioration of experimental colitis after short‐term therapy with glucocorticoid and its relationship to the induction of different regulatory markers by Sales‐Campos, Helioswilton, Souza, Patrícia R., Basso, Paulo J., Nardini, Viviani, Silva, Angelica, Banquieri, Fernanda, Alves, Vanessa B. F., Chica, Javier E. L., Nomizo, Auro, Cardoso, Cristina R. B.

“…Summary The clinical benefits of short‐term therapy with glucocorticoids (GC) in patients with inflammatory bowel disease (IBD) are widely known. However, the…”
Get full text

Isolation and expression of a hypotensive and anti-platelet acidic phospholipase A2 from Bothrops moojeni snake venom by Silveira, Lucas B., Marchi-Salvador, Daniela P., Santos-Filho, Norival A., Silva, Floriano P., Marcussi, Silvana, Fuly, André L., Nomizo, Auro, da Silva, Saulo L., Stábeli, Rodrigo G., Arantes, Eliane C., Soares, Andreimar M.

“…► BmooPLA2. ► An acidic phospholipase A2. ► Native and recombinant enzyme. ► Anti-platelet and hypotensive properties. ► Potential therapeutic agents. ►…”
Get full text

Biochemical and functional characterization of an l-amino acid oxidase isolated from Bothrops pirajai snake venom by Izidoro, Luiz Fernando M., Ribeiro, Marcela C., Souza, Guilherme R.L., Sant’Ana, Carolina D., Hamaguchi, Amelia, Homsi-Brandeburgo, Maria I., Goulart, Luiz R., Beleboni, Rene O., Nomizo, Auro, Sampaio, Suely V., Soares, Andreimar M., Rodrigues, Veridiana M.

“…N-terminal sequence is: ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVG. The present investigation reports, the first time, the isolation and biochemical…”
Get full text