Search Results - "Arzumanian, V G"

Unfavorable Humoral Factors for Spermatozoon Survival in Vaginal Medium by Arzumanian, V. G., Beskov, A. A., Kulumbegova, L. T., Malbakhova, E. T., Svitich, O. A.

“…The effects of vaginal secretion, its antibacterial peptide fraction, albumin, and bacterial metabolites on the spermatozoon membranes were studied. Vaginal…”
Get full text

Antagonistic Activity of Malassezia Spp. towards Other Clinically Signifi cant Yeast Genera by Arzumanian, V. G, Sergeev, A. Yu, Shelemekh, O. V, Ojovan, I. M, Serdiuk, O. A

“…Antagonistic activity of Malassezia yeast towards clinically signifi cant yeast species was studied. Ten Malassezia strains exhibited this activity. M. furfur…”
Get full text

Effect of Rabbit Immunization with Yeast Antigens on the Activity of the Fraction of Serum Antimicrobial Peptides by Arzumanian, V. G., Iksanova, A. M., Artemyeva, T. A., Butovchenko, L. M.

“…The aim was to study the effect of rabbit immunization with different yeasts cells on overall antimicrobial serum activity and specific activity of…”
Get full text

Synthesis and Antimicrobial Activity of a New Drug Based on a Retro-Analog of Cathelicidin—Polypeptide SE-33 by Trenin, A. S., Arzumanian, V. G., Zhmak, M. N., Shelukhina, I. V., Makarova, Ya. V., Ivanov, I. A., Bychkova, O. P., Budikhina, A. S., Balyasova, L. S., Tsetlin, V. I.

“…— Polypeptide SE-33 (SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF), which is a retro analog of natural antimicrobial protein cathelicidin LL-37…”
Get full text

Antagonistic activity of Malassezia Spp. towards other clinically significant yeast genera by Arzumanian, V G, Sergeev, A Yu, Shelemekh, O V, Ojovan, I M, Serdiuk, O A

“…Antagonistic activity of Malassezia yeast towards clinically significant yeast species was studied. Ten Malassezia strains exhibited this activity. M. furfur…”
Get full text

Effect of Rabbit Immunization with Yeast Antigens on the Activity of the Fraction of Serum Antimicrobial Peptides by Arzumanian, V. G., Iksanova, A. M., Artemyeva, T. A., Butovchenko, L. M.

“…The aim was to study the effect of rabbit immunization with different yeasts cells on overall antimicrobial serum activity and specific activity of…”
Get full text

An impact of lactoferrin, serum albumin and secretory immunoglobulin A in actimicrobial activity of breast milk whey by Arzumanian, Vera G., Kolyganova, Tatiana I., Svitich, Oxana A., Samoylikov, Pavel V., Konanykhina, Svetlana Y., Zaytseva, Tatiana A., Zverev, Vitaly V.

“…The contribution of the antimicrobial activity of sIgA, lactoferrin, -lactalbumin, serum albumin, and lysozyme to the total antimicrobial activity of whey was…”
Get full text

Quantitative assessment of delayed antagonism of probiotic cultures against opportunistic yeasts by Arzumanian, V G, Mikhaĭlova, N A, Gaĭderov, A A, Basnak'ian, I A, Osipova, I G

Get more information

The use of real time PCR for quantitative determination of some propionic bacteria residing on human skin by Globa, A G, Alekseev, Ia I, Arzumanian, V G, Zaborova, V A, Guridova, A A

“…A test system has been developed for determination of propionic bacterial species residing on human skin. This system developed in the real time PCR format is…”
Get more information

Assessment of rate of hydroxyl anions production by Helicobacter pylori in stomach by Vartanova, N O, Arzumanian, V G

“…Production of hydroxyl anions by tissue samples of pylorus mucous membrane obtained from 45 patients with gastric or duodenal ulcers was investigated. The…”
Get more information

The use of real time PCR for quantitative determination of some propionic bacteria residing on human skin by Globa, A G, Alekseev, Ia I, Arzumanian, V G, Zaborova, V A, Guridov, A A

“…A test system has been developed for determination of propionic bacterial species residing on human skin. This system developed in the real time PCR format is…”
Get more information

Isolation and study of perspective probiotic strain of spore-forming bacteria from Bacillus genus by Grin'ko, O M, Zverev, V V, Kaloshin, A A, Mikhaĭlova, N A, Arzumanian, V G

“…To study physiologic, biochemical as well as antagonistic characteristics of isolated strain of Bacillus pumilus in comparison with known spore-forming…”
Get more information

Minimum inhibitory concentrations of various antifungal agents against Basidiomycetes clinical isolates by Arzumanian, V G

“…The basidiomycete yeasts are often isolated from clinical samples. A minimal inhibiting concentrations (MIC) of ten antifungals of different groups--azols,…”
Get more information

The yeast malassezia on the skin of healthy individuals and patients with atopic dermatitis by Arzumanian, V G

“…The lipophilic yeast Malassezia spp. from the skin of 32 healthy individuals and 21 patients with atopic dermatitis was isolated and identified. Malassezia…”
Get more information

Synthetic media for cultivation of lipophilic yeast malassezia spp by Arzumanian, V G

“…The capacity of the lipophilic yeast Malassezia spp. (Pityrosporum spp.) to grown in a synthetic nutritional media has been studied. The modified Dixon's…”
Get more information

Influence of the degree of aeration on halotolerance of yeasts of the genera Candida, Rhodotorula, and Malassezia by Geĭdebrekht, O V, Arzumanian, V G, Plakunov, V K, Beliaev, S S

“…The biochemical mechanisms were studied that determine different reactions of yeasts of different genera to two simultaneously imposed stressors, hypoxia and…”
Get more information

Killer toxins of clinically important yeasts by Ozhovan, I M, Arzumanian, V G, Basnak'ian, I A

“…The review deals with some theoretical and applied aspects of the capacity of yeasts for synthesizing toxins. Similarly to antibiotic formation in micellar…”
Get more information

Antagonistic interactions between stress factors during the growth of microorganisms under conditions simulating the parameters of their natural ecotopes by Arzumanian, V G, Voronina, N A, Geĭdebrekht, O V, Shelemekh, O V, Plakunov, V K, Beliaev, S S

“…Two stress factors, hypoxia (microaerobic conditions) and a high salt concentration, if applied simultaneously to aerobic microorganisms, display an…”
Get more information

Yeast-like fungi malassezia (pityrosporum): clinical and immunological aspects fo study by Mokronosova, M A, Arzumanian, V G, Gervazieva, V B

“…The normal flora is typified by the yeast-like fungi Malassezia (Pityrosporum). Successful attempts at treating patients with atopic and seborreic dermatitis,…”
Get more information

The degree of halophily in Rhodococcus erythropolis and Halobacterium salinarum depends on the partial pressure of oxygen by Arzumanian, V G, Voronina, N A, Plakunov, V K, Beliaev, S S

Get more information